PRPF31,hPrp31
  • PRPF31,hPrp31

Anti-PRPF31 Antibody 100ul

Ref: AN-HPA061873-100ul
Anti-PRPF31

Información del producto

Polyclonal Antibody against Human PRPF31, Gene description: pre-mRNA processing factor 31, Alternative Gene Names: hPrp31, NY-BR-99, PRP31, RP11, SNRNP61, Validated applications: ICC, Uniprot ID: Q8WWY3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PRPF31
Gene Description pre-mRNA processing factor 31
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN
Immunogen SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hPrp31, NY-BR-99, PRP31, RP11, SNRNP61
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WWY3
HTS Code 3002150000
Gene ID 26121
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PRPF31 Antibody 100ul

Anti-PRPF31 Antibody 100ul