F11R,CD321,JAM-1
  • F11R,CD321,JAM-1

Anti-F11R Antibody 100ul

Ref: AN-HPA061700-100ul
Anti-F11R

Información del producto

Polyclonal Antibody against Human F11R, Gene description: F11 receptor, Alternative Gene Names: CD321, JAM-1, JAM-A, JAM1, JAMA, JCAM, PAM-1, Validated applications: IHC, Uniprot ID: Q9Y624, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name F11R
Gene Description F11 receptor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTR
Immunogen VHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD321, JAM-1, JAM-A, JAM1, JAMA, JCAM, PAM-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y624
HTS Code 3002150000
Gene ID 50848
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-F11R Antibody 100ul

Anti-F11R Antibody 100ul