LTBR,D12S370
  • LTBR,D12S370

Anti-LTBR Antibody 25ul

Ref: AN-HPA061617-25ul
Anti-LTBR

Información del producto

Polyclonal Antibody against Human LTBR, Gene description: lymphotoxin beta receptor, Alternative Gene Names: D12S370, TNF-R-III, TNFCR, TNFR-RP, TNFR2-RP, TNFRSF3, Validated applications: ICC, Uniprot ID: P36941, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LTBR
Gene Description lymphotoxin beta receptor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT
Immunogen EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D12S370, TNF-R-III, TNFCR, TNFR-RP, TNFR2-RP, TNFRSF3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P36941
HTS Code 3002150000
Gene ID 4055
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LTBR Antibody 25ul

Anti-LTBR Antibody 25ul