PEF1,PEF1A
  • PEF1,PEF1A

Anti-PEF1 Antibody 100ul

Ref: AN-HPA061608-100ul
Anti-PEF1

Información del producto

Polyclonal Antibody against Human PEF1, Gene description: penta-EF-hand domain containing 1, Alternative Gene Names: PEF1A, Validated applications: ICC, WB, Uniprot ID: Q9UBV8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PEF1
Gene Description penta-EF-hand domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence PPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAA
Immunogen PPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PEF1A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBV8
HTS Code 3002150000
Gene ID 553115
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PEF1 Antibody 100ul

Anti-PEF1 Antibody 100ul