PHLDB1,FLJ00141
  • PHLDB1,FLJ00141

Anti-PHLDB1 Antibody 25ul

Ref: AN-HPA061506-25ul
Anti-PHLDB1

Información del producto

Polyclonal Antibody against Human PHLDB1, Gene description: pleckstrin homology-like domain, family B, member 1, Alternative Gene Names: FLJ00141, KIAA0638, LL5a, Validated applications: ICC, Uniprot ID: Q86UU1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PHLDB1
Gene Description pleckstrin homology-like domain, family B, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GTLTLYPCGNACTIDGLPVRQPTRLTQGCMLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPVPAESESLVNGNHT
Immunogen GTLTLYPCGNACTIDGLPVRQPTRLTQGCMLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPVPAESESLVNGNHT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ00141, KIAA0638, LL5a
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86UU1
HTS Code 3002150000
Gene ID 23187
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PHLDB1 Antibody 25ul

Anti-PHLDB1 Antibody 25ul