TACC2,AZU-1
  • TACC2,AZU-1

Anti-TACC2 Antibody 25ul

Ref: AN-HPA061394-25ul
Anti-TACC2

Información del producto

Polyclonal Antibody against Human TACC2, Gene description: transforming, acidic coiled-coil containing protein 2, Alternative Gene Names: AZU-1, Validated applications: ICC, WB, Uniprot ID: O95359, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TACC2
Gene Description transforming, acidic coiled-coil containing protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence LSTFVNETKFSSPTEELDYRNSYEIEYMEKIGSSLPQDDDAPKKQALYLMFDTSQESPVKSSPVRMSESPTPCSGSSF
Immunogen LSTFVNETKFSSPTEELDYRNSYEIEYMEKIGSSLPQDDDAPKKQALYLMFDTSQESPVKSSPVRMSESPTPCSGSSF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AZU-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95359
HTS Code 3002150000
Gene ID 10579
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TACC2 Antibody 25ul

Anti-TACC2 Antibody 25ul