GIN1,FLJ20125,GIN-1
  • GIN1,FLJ20125,GIN-1

Anti-GIN1 Antibody 100ul

Ref: AN-HPA061362-100ul
Anti-GIN1

Información del producto

Polyclonal Antibody against Human GIN1, Gene description: gypsy retrotransposon integrase 1, Alternative Gene Names: FLJ20125, GIN-1, TGIN1, ZH2C2, Validated applications: ICC, Uniprot ID: Q9NXP7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GIN1
Gene Description gypsy retrotransposon integrase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence WKDGRFQSEWVGPCVIDYITESGCAVLRDNTGVRLKRPIKMSHLKPYIRESSEQESLYLLQGSVVADHDYIGLPEIPIGA
Immunogen WKDGRFQSEWVGPCVIDYITESGCAVLRDNTGVRLKRPIKMSHLKPYIRESSEQESLYLLQGSVVADHDYIGLPEIPIGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20125, GIN-1, TGIN1, ZH2C2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NXP7
HTS Code 3002150000
Gene ID 54826
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GIN1 Antibody 100ul

Anti-GIN1 Antibody 100ul