MINDY1,FAM63A
  • MINDY1,FAM63A

Anti-MINDY1 Antibody 100ul

Ref: AN-HPA061086-100ul
Anti-MINDY1

Información del producto

Polyclonal Antibody against Human MINDY1, Gene description: MINDY lysine 48 deubiquitinase 1, Alternative Gene Names: FAM63A, FLJ11280, MINDY-1, Validated applications: ICC, Uniprot ID: Q8N5J2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MINDY1
Gene Description MINDY lysine 48 deubiquitinase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence YLIALSLQQQQPRGPLGLTDLELAQQLQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCI
Immunogen YLIALSLQQQQPRGPLGLTDLELAQQLQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM63A, FLJ11280, MINDY-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N5J2
HTS Code 3002150000
Gene ID 55793
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MINDY1 Antibody 100ul

Anti-MINDY1 Antibody 100ul