FOXL2NB,C3orf72
  • FOXL2NB,C3orf72

Anti-FOXL2NB Antibody 100ul

Ref: AN-HPA061017-100ul
Anti-FOXL2NB

Información del producto

Polyclonal Antibody against Human FOXL2NB, Gene description: FOXL2 neighbor, Alternative Gene Names: C3orf72, FLJ43329, Validated applications: ICC, WB, Uniprot ID: Q6ZUU3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FOXL2NB
Gene Description FOXL2 neighbor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence PALVKKRMPDACTLGRAGIGLPKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEA
Immunogen PALVKKRMPDACTLGRAGIGLPKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C3orf72, FLJ43329
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZUU3
HTS Code 3002150000
Gene ID 401089
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FOXL2NB Antibody 100ul

Anti-FOXL2NB Antibody 100ul