HINFP,DKFZP434F162
  • HINFP,DKFZP434F162

Anti-HINFP Antibody 100ul

Ref: AN-HPA061008-100ul
Anti-HINFP

Información del producto

Polyclonal Antibody against Human HINFP, Gene description: histone H4 transcription factor, Alternative Gene Names: DKFZP434F162, HiNF-P, MIZF, ZNF743, Validated applications: WB, Uniprot ID: Q9BQA5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HINFP
Gene Description histone H4 transcription factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence GHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESSLQGIILETVPGEPGRKE
Immunogen GHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESSLQGIILETVPGEPGRKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434F162, HiNF-P, MIZF, ZNF743
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BQA5
HTS Code 3002150000
Gene ID 25988
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HINFP Antibody 100ul

Anti-HINFP Antibody 100ul