GDF11,BMP-11
  • GDF11,BMP-11

Anti-GDF11 Antibody 100ul

Ref: AN-HPA060985-100ul
Anti-GDF11

Información del producto

Polyclonal Antibody against Human GDF11, Gene description: growth differentiation factor 11, Alternative Gene Names: BMP-11, Validated applications: ICC, Uniprot ID: O95390, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GDF11
Gene Description growth differentiation factor 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DFQGDALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMF
Immunogen DFQGDALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BMP-11
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95390
HTS Code 3002150000
Gene ID 10220
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GDF11 Antibody 100ul

Anti-GDF11 Antibody 100ul