PGM2L1,BM32A
  • PGM2L1,BM32A

Anti-PGM2L1 Antibody 100ul

Ref: AN-HPA060948-100ul
Anti-PGM2L1

Información del producto

Polyclonal Antibody against Human PGM2L1, Gene description: phosphoglucomutase 2-like 1, Alternative Gene Names: BM32A, FLJ32029, Validated applications: ICC, Uniprot ID: Q6PCE3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PGM2L1
Gene Description phosphoglucomutase 2-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAV
Immunogen GLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BM32A, FLJ32029
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PCE3
HTS Code 3002150000
Gene ID 283209
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PGM2L1 Antibody 100ul

Anti-PGM2L1 Antibody 100ul