RBBP4,lin-53,NURF55
  • RBBP4,lin-53,NURF55

Anti-RBBP4 Antibody 25ul

Ref: AN-HPA060724-25ul
Anti-RBBP4

Información del producto

Polyclonal Antibody against Human RBBP4, Gene description: retinoblastoma binding protein 4, Alternative Gene Names: lin-53, NURF55, RbAp48, Validated applications: ICC, IHC, WB, Uniprot ID: Q09028, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RBBP4
Gene Description retinoblastoma binding protein 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence QWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMA
Immunogen QWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names lin-53, NURF55, RbAp48
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q09028
HTS Code 3002150000
Gene ID 5928
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RBBP4 Antibody 25ul

Anti-RBBP4 Antibody 25ul