TAS2R39
  • TAS2R39

Anti-TAS2R39 Antibody 100ul

Ref: AN-HPA060680-100ul
Anti-TAS2R39

Información del producto

Polyclonal Antibody against Human TAS2R39, Gene description: taste receptor, type 2, member 39, Validated applications: IHC, Uniprot ID: P59534, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TAS2R39
Gene Description taste receptor, type 2, member 39
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ICTVYCNNSFPIHSSNSTKKTYLSEINVVGL
Immunogen ICTVYCNNSFPIHSSNSTKKTYLSEINVVGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P59534
HTS Code 3002150000
Gene ID 259285
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TAS2R39 Antibody 100ul

Anti-TAS2R39 Antibody 100ul