CYTH2,ARNO,CTS18.1
  • CYTH2,ARNO,CTS18.1

Anti-CYTH2 Antibody 100ul

Ref: AN-HPA060662-100ul
Anti-CYTH2

Información del producto

Polyclonal Antibody against Human CYTH2, Gene description: cytohesin 2, Alternative Gene Names: ARNO, CTS18.1, cytohesin-2, PSCD2, PSCD2L, Sec7p-L, Sec7p-like, Validated applications: ICC, Uniprot ID: Q99418, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CYTH2
Gene Description cytohesin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF
Immunogen REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARNO, CTS18.1, cytohesin-2, PSCD2, PSCD2L, Sec7p-L, Sec7p-like
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99418
HTS Code 3002150000
Gene ID 9266
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CYTH2 Antibody 100ul

Anti-CYTH2 Antibody 100ul