CBFA2T2,MTGR1,ZMYND3
  • CBFA2T2,MTGR1,ZMYND3

Anti-CBFA2T2 Antibody 100ul

Ref: AN-HPA060523-100ul
Anti-CBFA2T2

Información del producto

Polyclonal Antibody against Human CBFA2T2, Gene description: core-binding factor, runt domain, alpha subunit 2; translocated to, 2, Alternative Gene Names: MTGR1, ZMYND3, Validated applications: IHC, WB, Uniprot ID: O43439, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CBFA2T2
Gene Description core-binding factor, runt domain, alpha subunit 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL
Immunogen MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MTGR1, ZMYND3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43439
HTS Code 3002150000
Gene ID 9139
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CBFA2T2 Antibody 100ul

Anti-CBFA2T2 Antibody 100ul