SLC33A1,ACATN,AT-1
  • SLC33A1,ACATN,AT-1

Anti-SLC33A1 Antibody 100ul

Ref: AN-HPA060345-100ul
Anti-SLC33A1

Información del producto

Polyclonal Antibody against Human SLC33A1, Gene description: solute carrier family 33 member 1, Alternative Gene Names: ACATN, AT-1, AT1, SPG42, Validated applications: ICC, Uniprot ID: O00400, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC33A1
Gene Description solute carrier family 33 member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS
Immunogen PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ACATN, AT-1, AT1, SPG42
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00400
HTS Code 3002150000
Gene ID 9197
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC33A1 Antibody 100ul

Anti-SLC33A1 Antibody 100ul