KLHL34,FLJ34960
  • KLHL34,FLJ34960

Anti-KLHL34 Antibody 100ul

Ref: AN-HPA060287-100ul
Anti-KLHL34

Información del producto

Polyclonal Antibody against Human KLHL34, Gene description: kelch-like family member 34, Alternative Gene Names: FLJ34960, RP11-450P7.3, Validated applications: IHC, Uniprot ID: Q8N239, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KLHL34
Gene Description kelch-like family member 34
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DRGVVYISGGKAGRGEGGASSLRDLYVLGPEEQVWSKKAPMGTARFGHHMAVLRGAVFAFLGRYEPFSEIERYDPGADQWTR
Immunogen DRGVVYISGGKAGRGEGGASSLRDLYVLGPEEQVWSKKAPMGTARFGHHMAVLRGAVFAFLGRYEPFSEIERYDPGADQWTR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ34960, RP11-450P7.3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N239
HTS Code 3002150000
Gene ID 257240
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KLHL34 Antibody 100ul

Anti-KLHL34 Antibody 100ul