NCOA2,bHLHe75,GRIP1
  • NCOA2,bHLHe75,GRIP1

Anti-NCOA2 Antibody 25ul

Ref: AN-HPA060243-25ul
Anti-NCOA2

Información del producto

Polyclonal Antibody against Human NCOA2, Gene description: nuclear receptor coactivator 2, Alternative Gene Names: bHLHe75, GRIP1, KAT13C, NCoA-2, TIF2, Validated applications: ICC, Uniprot ID: Q15596, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NCOA2
Gene Description nuclear receptor coactivator 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV
Immunogen PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHe75, GRIP1, KAT13C, NCoA-2, TIF2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15596
HTS Code 3002150000
Gene ID 10499
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NCOA2 Antibody 25ul

Anti-NCOA2 Antibody 25ul