POFUT1,FUT12
  • POFUT1,FUT12

Anti-POFUT1 Antibody 100ul

Ref: AN-HPA059935-100ul
Anti-POFUT1

Información del producto

Polyclonal Antibody against Human POFUT1, Gene description: protein O-fucosyltransferase 1, Alternative Gene Names: FUT12, KIAA0180, O-Fuc-T, O-FUT, Validated applications: ICC, Uniprot ID: Q9H488, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name POFUT1
Gene Description protein O-fucosyltransferase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence AVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSEL
Immunogen AVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FUT12, KIAA0180, O-Fuc-T, O-FUT
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H488
HTS Code 3002150000
Gene ID 23509
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-POFUT1 Antibody 100ul

Anti-POFUT1 Antibody 100ul