MINOS1,C1orf151
  • MINOS1,C1orf151

Anti-MINOS1 Antibody 100ul

Ref: AN-HPA059930-100ul
Anti-MINOS1

Información del producto

Polyclonal Antibody against Human MINOS1, Gene description: mitochondrial inner membrane organizing system 1, Alternative Gene Names: C1orf151, FLJ36999, MIO10, RP5-1056L3.2, Validated applications: ICC, IHC, Uniprot ID: Q5TGZ0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MINOS1
Gene Description mitochondrial inner membrane organizing system 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE
Immunogen RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf151, FLJ36999, MIO10, RP5-1056L3.2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5TGZ0
HTS Code 3002150000
Gene ID 440574
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MINOS1 Antibody 100ul

Anti-MINOS1 Antibody 100ul