FEM1C
  • FEM1C

Anti-FEM1C Antibody 100ul

Ref: AN-HPA059919-100ul
Anti-FEM1C

Información del producto

Polyclonal Antibody against Human FEM1C, Gene description: fem-1 homolog c (C. elegans), Alternative Gene Names: EUROIMAGE686608, EUROIMAGE783647, FEM1A, KIAA1785, Validated applications: ICC, IHC, WB, Uniprot ID: Q96JP0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FEM1C
Gene Description fem-1 homolog c (C. elegans)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence NLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGHI
Immunogen NLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGHI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EUROIMAGE686608, EUROIMAGE783647, FEM1A, KIAA1785
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96JP0
HTS Code 3002150000
Gene ID 56929
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FEM1C Antibody 100ul

Anti-FEM1C Antibody 100ul