EMILIN3,C20orf130
  • EMILIN3,C20orf130

Anti-EMILIN3 Antibody 100ul

Ref: AN-HPA059912-100ul
Anti-EMILIN3

Información del producto

Polyclonal Antibody against Human EMILIN3, Gene description: elastin microfibril interfacer 3, Alternative Gene Names: C20orf130, dJ620E11.4, EMILIN5, Validated applications: IHC, Uniprot ID: Q9NT22, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EMILIN3
Gene Description elastin microfibril interfacer 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SPHGRKGPGLFGERLERLEGDVQRLAQTYGTLSGLVASHEDPNRMTGGPRAPAVPVGFGVIPEGLVGPGDRARGPLTPPLDEILSKVTEVSNTLQT
Immunogen SPHGRKGPGLFGERLERLEGDVQRLAQTYGTLSGLVASHEDPNRMTGGPRAPAVPVGFGVIPEGLVGPGDRARGPLTPPLDEILSKVTEVSNTLQT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf130, dJ620E11.4, EMILIN5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NT22
HTS Code 3002150000
Gene ID 90187
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EMILIN3 Antibody 100ul

Anti-EMILIN3 Antibody 100ul