MAU2,KIAA0892,mau-2
  • MAU2,KIAA0892,mau-2

Anti-MAU2 Antibody 100ul

Ref: AN-HPA059897-100ul
Anti-MAU2

Información del producto

Polyclonal Antibody against Human MAU2, Gene description: MAU2 sister chromatid cohesion factor, Alternative Gene Names: KIAA0892, mau-2, MAU2L, MGC75361, SCC4, Validated applications: ICC, Uniprot ID: Q9Y6X3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAU2
Gene Description MAU2 sister chromatid cohesion factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence HWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSPRLFSNHAAQ
Immunogen HWLPKEHMCVLVYLVTVMHSMQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEISQVCQLCQQSPRLFSNHAAQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0892, mau-2, MAU2L, MGC75361, SCC4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6X3
HTS Code 3002150000
Gene ID 23383
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAU2 Antibody 100ul

Anti-MAU2 Antibody 100ul