TNFSF9,4-1BB-L
  • TNFSF9,4-1BB-L

Anti-TNFSF9 Antibody 25ul

Ref: AN-HPA059857-25ul
Anti-TNFSF9

Información del producto

Polyclonal Antibody against Human TNFSF9, Gene description: tumor necrosis factor (ligand) superfamily, member 9, Alternative Gene Names: 4-1BB-L, Validated applications: ICC, Uniprot ID: P41273, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TNFSF9
Gene Description tumor necrosis factor (ligand) superfamily, member 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL
Immunogen SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 4-1BB-L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P41273
HTS Code 3002150000
Gene ID 8744
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TNFSF9 Antibody 25ul

Anti-TNFSF9 Antibody 25ul