ANKRD62
  • ANKRD62

Anti-ANKRD62 Antibody 100ul

Ref: AN-HPA059835-100ul
Anti-ANKRD62

Información del producto

Polyclonal Antibody against Human ANKRD62, Gene description: ankyrin repeat domain 62, Alternative Gene Names: DKFZp779B1634, Validated applications: IHC, Uniprot ID: A6NC57, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ANKRD62
Gene Description ankyrin repeat domain 62
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RRRMATWRKNRDKDGFSNPGYRVRQKDLGMIHKAAIAGDVNKVMESILLRLNDLNDRDKKN
Immunogen RRRMATWRKNRDKDGFSNPGYRVRQKDLGMIHKAAIAGDVNKVMESILLRLNDLNDRDKKN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp779B1634
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A6NC57
HTS Code 3002150000
Gene ID 342850
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ANKRD62 Antibody 100ul

Anti-ANKRD62 Antibody 100ul