RFX8,FLJ42986
  • RFX8,FLJ42986

Anti-RFX8 Antibody 25ul

Ref: AN-HPA059745-25ul
Anti-RFX8

Información del producto

Polyclonal Antibody against Human RFX8, Gene description: RFX family member 8, lacking RFX DNA binding domain, Alternative Gene Names: FLJ42986, Validated applications: ICC, WB, Uniprot ID: Q6ZV50, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RFX8
Gene Description RFX family member 8, lacking RFX DNA binding domain
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence LLQISKLKEVTLFVKRLRRKTYLSNMAKTMRMVLKSKRRVSVLKSDLQAIINQGTLATSKKALASDRSGADELENNPEMKCL
Immunogen LLQISKLKEVTLFVKRLRRKTYLSNMAKTMRMVLKSKRRVSVLKSDLQAIINQGTLATSKKALASDRSGADELENNPEMKCL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ42986
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZV50
HTS Code 3002150000
Gene ID 731220
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RFX8 Antibody 25ul

Anti-RFX8 Antibody 25ul