C19orf33,H2RSP,IMUP
  • C19orf33,H2RSP,IMUP

Anti-C19orf33 Antibody 25ul

Ref: AN-HPA059696-25ul
Anti-C19orf33

Información del producto

Polyclonal Antibody against Human C19orf33, Gene description: chromosome 19 open reading frame 33, Alternative Gene Names: H2RSP, IMUP, IMUP-1, IMUP-2, Validated applications: ICC, Uniprot ID: Q9GZP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C19orf33
Gene Description chromosome 19 open reading frame 33
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSS
Immunogen MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names H2RSP, IMUP, IMUP-1, IMUP-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9GZP8
HTS Code 3002150000
Gene ID 64073
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C19orf33 Antibody 25ul

Anti-C19orf33 Antibody 25ul