HCFC1R1,FLJ20568
  • HCFC1R1,FLJ20568

Anti-HCFC1R1 Antibody 25ul

Ref: AN-HPA059647-25ul
Anti-HCFC1R1

Información del producto

Polyclonal Antibody against Human HCFC1R1, Gene description: host cell factor C1 regulator 1 (XPO1 dependent), Alternative Gene Names: FLJ20568, HPIP, Validated applications: ICC, IHC, Uniprot ID: Q9NWW0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HCFC1R1
Gene Description host cell factor C1 regulator 1 (XPO1 dependent)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEEN
Immunogen QPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEEN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20568, HPIP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NWW0
HTS Code 3002150000
Gene ID 54985
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HCFC1R1 Antibody 25ul

Anti-HCFC1R1 Antibody 25ul