C2orf73,FLJ40298
  • C2orf73,FLJ40298

Anti-C2orf73 Antibody 25ul

Ref: AN-HPA059596-25ul
Anti-C2orf73

Información del producto

Polyclonal Antibody against Human C2orf73, Gene description: chromosome 2 open reading frame 73, Alternative Gene Names: FLJ40298, Validated applications: IHC, Uniprot ID: Q8N5S3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C2orf73
Gene Description chromosome 2 open reading frame 73
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SCPLVLPVKHSKMQKPSCGIVPLASPGTSAELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKPGSRPTVPKGA
Immunogen SCPLVLPVKHSKMQKPSCGIVPLASPGTSAELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKPGSRPTVPKGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ40298
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N5S3
HTS Code 3002150000
Gene ID 129852
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C2orf73 Antibody 25ul

Anti-C2orf73 Antibody 25ul