MAZ,Pur-1,ZF87
  • MAZ,Pur-1,ZF87

Anti-MAZ Antibody 100ul

Ref: AN-HPA059495-100ul
Anti-MAZ

Información del producto

Polyclonal Antibody against Human MAZ, Gene description: MYC-associated zinc finger protein (purine-binding transcription factor), Alternative Gene Names: Pur-1, ZF87, Zif87, ZNF801, Validated applications: ICC, Uniprot ID: P56270, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAZ
Gene Description MYC-associated zinc finger protein (purine-binding transcription factor)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA
Immunogen PTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Pur-1, ZF87, Zif87, ZNF801
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P56270
HTS Code 3002150000
Gene ID 4150
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAZ Antibody 100ul

Anti-MAZ Antibody 100ul