JUN,AP-1,c-Jun
  • JUN,AP-1,c-Jun

Anti-JUN Antibody 25ul

Ref: AN-HPA059474-25ul
Anti-JUN

Información del producto

Polyclonal Antibody against Human JUN, Gene description: jun proto-oncogene, Alternative Gene Names: AP-1, c-Jun, Validated applications: ICC, WB, Uniprot ID: P05412, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name JUN
Gene Description jun proto-oncogene
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT
Immunogen METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP-1, c-Jun
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P05412
HTS Code 3002150000
Gene ID 3725
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-JUN Antibody 25ul

Anti-JUN Antibody 25ul