ZDHHC12,FLJ14524 Ver mas grande

Anti-ZDHHC12 Antibody 25ul

AN-HPA059339-25ul

Producto nuevo

Anti-ZDHHC12

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 25ul
Gene Name ZDHHC12
Gene Description zinc finger, DHHC-type containing 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRY
Immunogen MDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ14524, ZNF400
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96GR4
HTS Code 3002150000
Gene ID 84885
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación IHC, ICC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human ZDHHC12, Gene description: zinc finger, DHHC-type containing 12, Alternative Gene Names: FLJ14524, ZNF400, Validated applications: IHC, Uniprot ID: Q96GR4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image