JMJD6,KIAA0585
  • JMJD6,KIAA0585

Anti-JMJD6 Antibody 25ul

Ref: AN-HPA059156-25ul
Anti-JMJD6

Información del producto

Polyclonal Antibody against Human JMJD6, Gene description: jumonji domain containing 6, Alternative Gene Names: KIAA0585, PTDSR, PTDSR1, Validated applications: ICC, Uniprot ID: Q6NYC1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name JMJD6
Gene Description jumonji domain containing 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence STPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLA
Immunogen STPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0585, PTDSR, PTDSR1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6NYC1
HTS Code 3002150000
Gene ID 23210
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-JMJD6 Antibody 25ul

Anti-JMJD6 Antibody 25ul