GALNT16,GalNAc-T16
  • GALNT16,GalNAc-T16

Anti-GALNT16 Antibody 100ul

Ref: AN-HPA059136-100ul
Anti-GALNT16

Información del producto

Polyclonal Antibody against Human GALNT16, Gene description: polypeptide N-acetylgalactosaminyltransferase 16, Alternative Gene Names: GalNAc-T16, GALNTL1, KIAA1130, Validated applications: ICC, IHC, Uniprot ID: Q8N428, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GALNT16
Gene Description polypeptide N-acetylgalactosaminyltransferase 16
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPH
Immunogen ATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GalNAc-T16, GALNTL1, KIAA1130
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N428
HTS Code 3002150000
Gene ID 57452
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GALNT16 Antibody 100ul

Anti-GALNT16 Antibody 100ul