SEL1L2,C20orf50
  • SEL1L2,C20orf50

Anti-SEL1L2 Antibody 100ul

Ref: AN-HPA059121-100ul
Anti-SEL1L2

Información del producto

Polyclonal Antibody against Human SEL1L2, Gene description: sel-1 suppressor of lin-12-like 2 (C. elegans), Alternative Gene Names: C20orf50, DKFZp434C1826, Validated applications: IHC, Uniprot ID: Q5TEA6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SEL1L2
Gene Description sel-1 suppressor of lin-12-like 2 (C. elegans)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FGSAGGNMMSQMILGYRYLSGINVLQNCEVALSYYKKVADYIADTFEKSEGVPVEKVRLTERPENLSSNSEILDWDIYQYYKFLAERGDVQIQVSL
Immunogen FGSAGGNMMSQMILGYRYLSGINVLQNCEVALSYYKKVADYIADTFEKSEGVPVEKVRLTERPENLSSNSEILDWDIYQYYKFLAERGDVQIQVSL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf50, DKFZp434C1826
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5TEA6
HTS Code 3002150000
Gene ID 80343
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SEL1L2 Antibody 100ul

Anti-SEL1L2 Antibody 100ul