RP11-849H4.2
  • RP11-849H4.2

Anti-RP11-849H4.2 Antibody 100ul

Ref: AN-HPA058841-100ul
Anti-RP11-849H4.2

Información del producto

Polyclonal Antibody against Human RP11-849H4.2, Gene description: Putative short transient receptor potential channel 2-like protein , Validated applications: ICC, Uniprot ID: Q6ZNB5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RP11-849H4.2
Gene Description Putative short transient receptor potential channel 2-like protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MAPVKISHVVSFSSQDPKYPVENLLNPDSPRRPWLGCPQDKSGQLKVELQLERAVPTGYIDVGNCGCAFLQ
Immunogen MAPVKISHVVSFSSQDPKYPVENLLNPDSPRRPWLGCPQDKSGQLKVELQLERAVPTGYIDVGNCGCAFLQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZNB5
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RP11-849H4.2 Antibody 100ul

Anti-RP11-849H4.2 Antibody 100ul