AACS,ACSF1,FLJ12389
  • AACS,ACSF1,FLJ12389

Anti-AACS Antibody 25ul

Ref: AN-HPA058815-25ul
Anti-AACS

Información del producto

Polyclonal Antibody against Human AACS, Gene description: acetoacetyl-CoA synthetase, Alternative Gene Names: ACSF1, FLJ12389, SUR-5, Validated applications: ICC, IHC, Uniprot ID: Q86V21, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name AACS
Gene Description acetoacetyl-CoA synthetase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence RVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVI
Immunogen RVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ACSF1, FLJ12389, SUR-5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86V21
HTS Code 3002150000
Gene ID 65985
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-AACS Antibody 25ul

Anti-AACS Antibody 25ul