UBL3,DKFZP434K151
  • UBL3,DKFZP434K151

Anti-UBL3 Antibody 25ul

Ref: AN-HPA058781-25ul
Anti-UBL3

Información del producto

Polyclonal Antibody against Human UBL3, Gene description: ubiquitin-like 3, Alternative Gene Names: DKFZP434K151, FLJ32018, HCG-1, PNSC1, Validated applications: IHC, Uniprot ID: O95164, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UBL3
Gene Description ubiquitin-like 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Immunogen LIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434K151, FLJ32018, HCG-1, PNSC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95164
HTS Code 3002150000
Gene ID 5412
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UBL3 Antibody 25ul

Anti-UBL3 Antibody 25ul