PPM1H,ARHCL1
  • PPM1H,ARHCL1

Anti-PPM1H Antibody 25ul

Ref: AN-HPA058777-25ul
Anti-PPM1H

Información del producto

Polyclonal Antibody against Human PPM1H, Gene description: protein phosphatase, Mg2+/Mn2+ dependent, 1H, Alternative Gene Names: ARHCL1, FLJ13253, KIAA1157, NERPP-2C, Validated applications: ICC, IHC, Uniprot ID: Q9ULR3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PPM1H
Gene Description protein phosphatase, Mg2+/Mn2+ dependent, 1H
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKETRR
Immunogen MAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKETRR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARHCL1, FLJ13253, KIAA1157, NERPP-2C
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULR3
HTS Code 3002150000
Gene ID 57460
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPM1H Antibody 25ul

Anti-PPM1H Antibody 25ul