PUS7L,DKFZP434G1415
  • PUS7L,DKFZP434G1415

Anti-PUS7L Antibody 25ul

Ref: AN-HPA058750-25ul
Anti-PUS7L

Información del producto

Polyclonal Antibody against Human PUS7L, Gene description: pseudouridylate synthase 7 homolog (S. cerevisiae)-like, Alternative Gene Names: DKFZP434G1415, Validated applications: IHC, Uniprot ID: Q9H0K6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PUS7L
Gene Description pseudouridylate synthase 7 homolog (S. cerevisiae)-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EYKELCHLVSEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVNKKFGNLVETKSFSKMNCSAGNPNVVVTVRFREKAHKRGKR
Immunogen EYKELCHLVSEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVNKKFGNLVETKSFSKMNCSAGNPNVVVTVRFREKAHKRGKR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434G1415
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H0K6
HTS Code 3002150000
Gene ID 83448
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PUS7L Antibody 25ul

Anti-PUS7L Antibody 25ul