CCDC62,CT109,ERAP75
  • CCDC62,CT109,ERAP75

Anti-CCDC62 Antibody 25ul

Ref: AN-HPA058741-25ul
Anti-CCDC62

Información del producto

Polyclonal Antibody against Human CCDC62, Gene description: coiled-coil domain containing 62, Alternative Gene Names: CT109, ERAP75, FLJ40344, TSP-NY, Validated applications: IHC, Uniprot ID: Q6P9F0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCDC62
Gene Description coiled-coil domain containing 62
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MERSEISCCQKNEACLGESGMCDSKCCHPSNFIIEAPGHMSDVEWMSIFKPSKMQRIVRLKSGCTCSESICGTQHDSPASELIAIQDSHSLGSSKSALREDETES
Immunogen MERSEISCCQKNEACLGESGMCDSKCCHPSNFIIEAPGHMSDVEWMSIFKPSKMQRIVRLKSGCTCSESICGTQHDSPASELIAIQDSHSLGSSKSALREDETES
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT109, ERAP75, FLJ40344, TSP-NY
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P9F0
HTS Code 3002150000
Gene ID 84660
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCDC62 Antibody 25ul

Anti-CCDC62 Antibody 25ul