STAG1,SA-1,SA1,SCC3A
  • STAG1,SA-1,SA1,SCC3A

Anti-STAG1 Antibody 100ul

Ref: AN-HPA058653-100ul
Anti-STAG1

Información del producto

Polyclonal Antibody against Human STAG1, Gene description: stromal antigen 1, Alternative Gene Names: SA-1, SA1, SCC3A, Validated applications: ICC, Uniprot ID: Q8WVM7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STAG1
Gene Description stromal antigen 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKGRPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLT
Immunogen RNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKGRPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SA-1, SA1, SCC3A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WVM7
HTS Code 3002150000
Gene ID 10274
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-STAG1 Antibody 100ul

Anti-STAG1 Antibody 100ul