GUCY1A3,GC-SA3
  • GUCY1A3,GC-SA3

Anti-GUCY1A3 Antibody 100ul

Ref: AN-HPA058617-100ul
Anti-GUCY1A3

Información del producto

Polyclonal Antibody against Human GUCY1A3, Gene description: guanylate cyclase 1 soluble subunit alpha, Alternative Gene Names: GC-SA3, GUC1A3, Validated applications: ICC, Uniprot ID: Q02108, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GUCY1A3
Gene Description guanylate cyclase 1 soluble subunit alpha
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIR
Immunogen PPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GC-SA3, GUC1A3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q02108
HTS Code 3002150000
Gene ID 2982
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GUCY1A3 Antibody 100ul

Anti-GUCY1A3 Antibody 100ul