ERF,PE-2,PE2
  • ERF,PE-2,PE2

Anti-ERF Antibody 100ul

Ref: AN-HPA058532-100ul
Anti-ERF

Información del producto

Polyclonal Antibody against Human ERF, Gene description: Ets2 repressor factor, Alternative Gene Names: PE-2, PE2, Validated applications: ICC, Uniprot ID: P50548, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ERF
Gene Description Ets2 repressor factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KPEPGEAPGASQCMPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRG
Immunogen KPEPGEAPGASQCMPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PE-2, PE2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P50548
HTS Code 3002150000
Gene ID 2077
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ERF Antibody 100ul

Anti-ERF Antibody 100ul