CYP20A1,CYP-M
  • CYP20A1,CYP-M

Anti-CYP20A1 Antibody 25ul

Ref: AN-HPA058461-25ul
Anti-CYP20A1

Información del producto

Polyclonal Antibody against Human CYP20A1, Gene description: cytochrome P450, family 20, subfamily A, polypeptide 1, Alternative Gene Names: CYP-M, Validated applications: IHC, Uniprot ID: Q6UW02, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CYP20A1
Gene Description cytochrome P450, family 20, subfamily A, polypeptide 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EVIRFQKNHGTVWSEIGKGFLDGSLDKNMTRKKQYEDALMQLESVLRNIIKERKGRNFSQHIFIDSLVQGNLNDQQILED
Immunogen EVIRFQKNHGTVWSEIGKGFLDGSLDKNMTRKKQYEDALMQLESVLRNIIKERKGRNFSQHIFIDSLVQGNLNDQQILED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CYP-M
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6UW02
HTS Code 3002150000
Gene ID 57404
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CYP20A1 Antibody 25ul

Anti-CYP20A1 Antibody 25ul