NTMT1,AD-003
  • NTMT1,AD-003

Anti-NTMT1 Antibody 100ul

Ref: AN-HPA058420-100ul
Anti-NTMT1

Información del producto

Polyclonal Antibody against Human NTMT1, Gene description: N-terminal Xaa-Pro-Lys N-methyltransferase 1, Alternative Gene Names: AD-003, C9orf32, HOMT1A, METTL11A, Validated applications: ICC, Uniprot ID: Q9BV86, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NTMT1
Gene Description N-terminal Xaa-Pro-Lys N-methyltransferase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT
Immunogen MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AD-003, C9orf32, HOMT1A, METTL11A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BV86
HTS Code 3002150000
Gene ID 28989
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NTMT1 Antibody 100ul

Anti-NTMT1 Antibody 100ul