TOX2,C20orf100
  • TOX2,C20orf100

Anti-TOX2 Antibody 100ul

Ref: AN-HPA058396-100ul
Anti-TOX2

Información del producto

Polyclonal Antibody against Human TOX2, Gene description: TOX high mobility group box family member 2, Alternative Gene Names: C20orf100, dJ1108D11.2, GCX-1, Validated applications: ICC, Uniprot ID: Q96NM4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TOX2
Gene Description TOX high mobility group box family member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence HEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGR
Immunogen HEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf100, dJ1108D11.2, GCX-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96NM4
HTS Code 3002150000
Gene ID 84969
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TOX2 Antibody 100ul

Anti-TOX2 Antibody 100ul