B4GALT6,beta4GalT-VI
  • B4GALT6,beta4GalT-VI

Anti-B4GALT6 Antibody 25ul

Ref: AN-HPA058284-25ul
Anti-B4GALT6

Información del producto

Polyclonal Antibody against Human B4GALT6, Gene description: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6, Alternative Gene Names: beta4GalT-VI, Validated applications: IHC, Uniprot ID: Q9UBX8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name B4GALT6
Gene Description UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWK
Immunogen TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names beta4GalT-VI
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBX8
HTS Code 3002150000
Gene ID 9331
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-B4GALT6 Antibody 25ul

Anti-B4GALT6 Antibody 25ul