TRMT10A,MGC27034
  • TRMT10A,MGC27034

Anti-TRMT10A Antibody 25ul

Ref: AN-HPA058241-25ul
Anti-TRMT10A

Información del producto

Polyclonal Antibody against Human TRMT10A, Gene description: tRNA methyltransferase 10A, Alternative Gene Names: MGC27034, RG9MTD2, TRM10, Validated applications: ICC, Uniprot ID: Q8TBZ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRMT10A
Gene Description tRNA methyltransferase 10A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SSEMLPAFIETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQRELRKQKRKE
Immunogen SSEMLPAFIETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQRELRKQKRKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC27034, RG9MTD2, TRM10
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TBZ6
HTS Code 3002150000
Gene ID 93587
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TRMT10A Antibody 25ul

Anti-TRMT10A Antibody 25ul